Перейти к контенту
Main image
Печать
Anti-MSX1
Кат. №: AV31396-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-MSX1
Main image
Кат. №: AV31396-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-MSX1
Кат. №: AV31396-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; MSX1 is a homeobox gene that functions as a transcriptional repressor during embryogenesis. MSX1 mutations have been linked to tooth agenesis and orofacial clefting. Rabbit Anti-MSX1 (AB1) antibody recognizes canine, rat, mouse, pig, and human MSX1.; Immunogen; Synthetic peptide directed towards the middle region of human MSX1; Application; Rabbit Anti-MSX1 (AB1) antibody can be used for western blot (2.0μg/ml) and immunohistochemistry (4-8μg/ml) applications.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Slightly proximal to the Huntington disease locus, the human MSX1 gene is deleted in patients with Wolf-Hirschhorn syndrome. This gene is also called HOX7. The Msx family of vertebrate HOX genes was originally isolated by homology to the Drosophila msh (muscle segment homeo box) gene. This is a candidate gene for human cleft palate.; Sequence; Synthetic peptide located within the following region: SLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRF
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; General description; MSX1 is a homeobox gene that functions as a transcriptional repressor during embryogenesis. MSX1 mutations have been linked to tooth agenesis and orofacial clefting. Rabbit Anti-MSX1 (AB1) antibody recognizes canine, rat, mouse, pig, and human MSX1.; Immunogen; Synthetic peptide directed towards the middle region of human MSX1; Application; Rabbit Anti-MSX1 (AB1) antibody can be used for western blot (2.0μg/ml) and immunohistochemistry (4-8μg/ml) applications.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Slightly proximal to the Huntington disease locus, the human MSX1 gene is deleted in patients with Wolf-Hirschhorn syndrome. This gene is also called HOX7. The Msx family of vertebrate HOX genes was originally isolated by homology to the Drosophila msh (muscle segment homeo box) gene. This is a candidate gene for human cleft palate.; Sequence; Synthetic peptide located within the following region: SLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRF
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.