Description; Immunogen; Synthetic peptide directed towards the N terminal region of human MTHFD2; Application; Anti-MTHFD2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; MTHFD2 encodes a mitochondrial bifunctional enzyme methylenetetrahydrofolate dehydrogenase/cyclohydrolase with NAD-dependent methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase domain. Decrease in MTHFD2 expression leads to impairment of cell migration and invasion into extracellular matrix and reduces the cell fraction with a high CD44 expression. It facilitates the regulation of breast cancer cell migration and invasion.; Sequence; Synthetic peptide located within the following region: LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE