Перейти к контенту
Main image
Печать
ANTI-MUC1
Кат. №: HPA008855-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
ANTI-MUC1
Main image
Кат. №: HPA008855-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
ANTI-MUC1
Кат. №: HPA008855-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ Immunogen_x000D_ mucin 1 isoform 5 precursor recombinant protein epitope signature tag (PrEST)_x000D_ Sequence_x000D_ AVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL_x000D_ Application_x000D_ Anti-MUC1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige._x000D_ Physical form_x000D_ Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC_x000D_ Biochem/physiol Actions_x000D_ MUC1 (mucin 1) is localized to the chromosomal locus which is the third most frequently rearranged site in non-Hodgkin′s lymphoma (NHL). Chromosomal translocation results in the activation of this gene, which is responsible for tumorigenesis in lymphomas. Due to chromosomal rearrangements, this gene is deregulated in leukemias, sarcomas, and epithelial tumors. This gene leads to the switching of SMAD3 signaling from tumor suppressive (pSmad3C/p21(WAF1)) to oncogenic pSmad3L/c-Myc. This leads to the activation of c-Jun NH2-terminal kinase (JNK) signaling in hepatocellular carcinoma (HCC). In cutaneous T-cell lymphoma (CTCL), this protein maintains redox balance, which prevents ROS (reactive oxygen species)-mediated apoptosis. Thus, it has potential as a therapeutic target in the same._x000D_ Features and Benefits_x000D_ Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section._x000D_ Every Prestige Antibody is tested in the following ways:_x000D_ • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues._x000D_ • Protein array of 364 human recombinant protein fragments._x000D_ • Validated for multiple commonly used applications such as IHC (Immunohistochemistry), IF (Immunofluorescence), and WB (Western Blot)_x000D_ Linkage_x000D_ Corresponding Antigen APREST70726.
Related Categories
Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies to Extracellular Matrix, Antibodies to Extracellular Matrix Proteins, ML-MZ, MS-MUD, Prestige Antibodies, Prestige Polyclonal Antibodies, Primary AntibodiesMore... product line
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ Immunogen_x000D_ mucin 1 isoform 5 precursor recombinant protein epitope signature tag (PrEST)_x000D_ Sequence_x000D_ AVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL_x000D_ Application_x000D_ Anti-MUC1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige._x000D_ Physical form_x000D_ Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC_x000D_ Biochem/physiol Actions_x000D_ MUC1 (mucin 1) is localized to the chromosomal locus which is the third most frequently rearranged site in non-Hodgkin′s lymphoma (NHL). Chromosomal translocation results in the activation of this gene, which is responsible for tumorigenesis in lymphomas. Due to chromosomal rearrangements, this gene is deregulated in leukemias, sarcomas, and epithelial tumors. This gene leads to the switching of SMAD3 signaling from tumor suppressive (pSmad3C/p21(WAF1)) to oncogenic pSmad3L/c-Myc. This leads to the activation of c-Jun NH2-terminal kinase (JNK) signaling in hepatocellular carcinoma (HCC). In cutaneous T-cell lymphoma (CTCL), this protein maintains redox balance, which prevents ROS (reactive oxygen species)-mediated apoptosis. Thus, it has potential as a therapeutic target in the same._x000D_ Features and Benefits_x000D_ Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section._x000D_ Every Prestige Antibody is tested in the following ways:_x000D_ • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues._x000D_ • Protein array of 364 human recombinant protein fragments._x000D_ • Validated for multiple commonly used applications such as IHC (Immunohistochemistry), IF (Immunofluorescence), and WB (Western Blot)_x000D_ Linkage_x000D_ Corresponding Antigen APREST70726.
Related Categories
Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies to Extracellular Matrix, Antibodies to Extracellular Matrix Proteins, ML-MZ, MS-MUD, Prestige Antibodies, Prestige Polyclonal Antibodies, Primary AntibodiesMore... product line
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.