Description; Immunogen; Synthetic peptide directed towards the N terminal region of human NCF4; Application; Anti-NCF4 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Anti-NCF4 antibody produced in rabbit is also referred as Anti-Neutrophil cytosolic factor 4, 40kDa, Anti-SH3PXD4 or Anti-P40PHOX. P40PHOX is a cytosolic component of the activation complex NADPH oxidase that regulates membrane translocation of p67phox and p47phox through the PB1-PC interaction. It facilitates production of superoxide, a multicomponent enzyme system important for host defense. The Px domain of the protein interacts with lipid products of PI3K proposes its role in PI3 kinase-mediated signaling pathway.; Sequence; Synthetic peptide located within the following region: SKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE