Печать
Anti-NEUROD6
Кат. №: AV32416-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-NEUROD6
Кат. №: AV32416-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; NEUROD6 is a basic helix-loop-helix (bHLH) transcription factor that belongs to the NeuroD subfamily of proteins. This transcription factor is regulated by promoters through CRE and C/EBP binding sites. Studies have reported that NeuroD6 defines novel retinal amacrine cells and modulates their fate.
Rabbit Anti-NEUROD6 (AB1) antibody recognizes canine, human, mouse, rat, bovine, and chicken NEUROD6.; Immunogen; Synthetic peptide directed towards the N terminal region of human NEUROD6; Application; Rabbit Anti-NEUROD6 (AB1) antibody can be used for western blot applications at a concentration of 0.5μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; NEUROD6 contains 1 basic helix-loop-helix (bHLH) domain. It activates E box-dependent transcription in collaboration with TCF3/E47 and may be a trans-acting factor involved in the development and maintenance of the mammalian nervous system. It transactivates the promoter of its own gene.; Sequence; Synthetic peptide located within the following region: MCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEEEEEDRE
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
