Перейти к контенту
Main image
Печать
Anti-NUP155
Кат. №: AV53620-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-NUP155
Main image
Кат. №: AV53620-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-NUP155
Кат. №: AV53620-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ Nuclear pore complex protein Nup155 is a protein encoded by the NUP155 gene in humans. NUP155 (nucleoporin 155kDa) gene encodes a peripheral membrane protein nucleoporin that belongs to non-repetitive/WGA-negative nucleoporin family. It is localized on to chromosome band 5p13. It is expressed in most tissues, including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human NUP155_x000D_ Application_x000D_ Anti-NUP155 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Nucleoporins are the main components of nuclear pore complexes (NPCs) involved both in binding and translocating proteins during nucleocytoplasmic transport. It plays a crucial role in the assembly and functioning of the NPCs that govern the movement of macromolecules across the nuclear envelope (NE). Loss of function mutation in NUP155 results in atrial fibrillation and cardiovascular disease._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY
Related Categories
Alphabetical Index, Antibodies, NS-NZ, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ Nuclear pore complex protein Nup155 is a protein encoded by the NUP155 gene in humans. NUP155 (nucleoporin 155kDa) gene encodes a peripheral membrane protein nucleoporin that belongs to non-repetitive/WGA-negative nucleoporin family. It is localized on to chromosome band 5p13. It is expressed in most tissues, including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human NUP155_x000D_ Application_x000D_ Anti-NUP155 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Nucleoporins are the main components of nuclear pore complexes (NPCs) involved both in binding and translocating proteins during nucleocytoplasmic transport. It plays a crucial role in the assembly and functioning of the NPCs that govern the movement of macromolecules across the nuclear envelope (NE). Loss of function mutation in NUP155 results in atrial fibrillation and cardiovascular disease._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY
Related Categories
Alphabetical Index, Antibodies, NS-NZ, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.