Description_x000D_ General description_x000D_ This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved in aspects of immunosuppression. (provided by RefSeq)_x000D_ Immunogen_x000D_ ORM1 (NP_000598.1, 1 a.a. ~ 201 a.a) full-length human protein._x000D_ Sequence_x000D_ MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4