Description; General description; PAX5 is a transcription factor that regulates the differentiation and functions of B cells. It has been reported that Blimp-1-mediated PAX5 repression facilitates plasmacytic differentiation of B cells. Furthermore, PAX5 has been implicated in human B cell malignancies. Rabbit Anti-PAX5 antibody recognizes human, mouse, rat, canine, zebrafish, and chicken PAX5.; Immunogen; Synthetic peptide directed towards the N terminal region of human PAX5; Application; Rabbit Anti-PAX5 antibody is suitable for western blot applications at a concentration of 2 μg/ml and for immunohistochemistry applications at 4-8 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; The PAX5 gene is a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box. The PAX proteins are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation. The PAX5 gene encodes the B-cell lineage specific activator protein (BSAP) that is expressed at early, but not late stages of B-cell differentiation. Its expression has also been detected in developing CNS and testis, therefore, PAX5 gene product may not only play an important role in B-cell differentiation, but also in neural development and spermatogenesis.; Sequence; Synthetic peptide located within the following region: CVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWE