Description_x000D_ General description_x000D_ PDPK1 is a kinase that regulates several signaling pathways mediated by various hormones and growth factors. PDPK1 has been implicated in breast cancer metastasis and prostate cancer progression._x000D_ Rabbit Anti-PDPK1 antibody recognizes human, mouse, rat, zebrafish, and pig PDPK1._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human PDPK1_x000D_ Application_x000D_ Rabbit Anti-PDPK1 antibody has been used for western blot assays at a concentration of 0.5μg/ml._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ PDPK1 phosphorylates and activates not only PKB/AKT, but also PKA, PKC-zeta, RPS6KA1 and RPS6KB1. It may play a general role in signaling processes and in development._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: IIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVS