Description_x000D_ Immunogen_x000D_ Synthetic peptide directed towards the C terminal region of human PDSS2_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ The isoprenoid chain of ubiquinone (coenzyme Q) varies in length between species and is determined by trans-polyprenyl diphosphate synthase. Humans possess a heterotetrameric decaprenyl diphosphate synthase composed of DPS1 (PDSS1; MIM 607429) and DLP1 (PDSS2) that produces Q10 ubiquinone.The isoprenoid chain of ubiquinone (coenzyme Q) varies in length between species and is determined by trans-polyprenyl diphosphate synthase. Humans possess a heterotetrameric decaprenyl diphosphate synthase composed of DPS1 (PDSS1; MIM 607429) and DLP1 (PDSS2) that produces Q10 ubiquinone (Saiki et al., 2005 [PubMed 16262699]).[supplied by OMIM]. Sequence Note: removed 1 base from the 5′ end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-24 DC341808.1 2-25 25-1292 BC039906.1 11-1278 1293-2534 AL832290.1 98-1339 2535-2535 BC039906.1 2521-2521 2536-3522 AL832290.1 1340-2326 3523-3568 AL832290.1 2328-2373_x000D_ Sequence_x000D_ Synthetic peptide located within the following region: IKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS