Description; General description; Peroxisomal biogenesis factor 3 (PEX3, TRG18), a PEX19 docking protin, and PEX19 have key roles in the biogenesis of peroxisomes. Membrane-anchored PEX3 functions as a PEX19 receptor, wherein PEX19 recognizes newly synthesized peroxisomal membrane proteins (PMP) and recruits them to the peroxisomal membrane.; Specificity; Anti-PEX3 polyclonal antibody reacts with bovine, human, mouse, rat, canine, zebrafish, and chicken peroxisomal biogenesis factor 3 proteins.; Immunogen; Synthetic peptide directed towards the N terminal region of human PEX3; Application; Anti-PEX3 polyclonal antibody is used to tag peroxisomal biogenesis factor 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of peroxisomal biogenesis factor 3 in peroxisome biosynthesis.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; PEX3 is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, it is necessary for the import of peroxisomal membrane proteins in the peroxisomes.; Sequence; Synthetic peptide located within the following region: KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL