Печать
Anti-PGAM2
Кат. №: AV48138
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-PGAM2
Кат. №: AV48138
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; Phosphoglycerate mutase 2 (muscle) (PGAM2) catalyzes the the conversion of 3-phosphoglycrate to 2-phosphoglycerate during glucolysis. Genetic alterations in PGAM2 have been linked to muscle phosphoglycerate mutase deficiency and Greig cephalopolysyndactyly syndrome.
Rabbit Anti-PGAM2 antibody recognizes human, mouse, rat, zebrafish, and pig PGAM2.; Immunogen; Synthetic peptide directed towards the N terminal region of human PGAM2; Application; Rabbit Anti-PGAM2 antibody is suitable for western blot applications at a concentration of 1μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; PGAM2 is the interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. It can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.; Sequence; Synthetic peptide located within the following region: MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKM
Properties
Aerobic Glycolysis (the Warburg Effect) Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
