Description_x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human POLR2K_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ POLR2K is one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases.This gene encodes one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR