Перейти к контенту
Main image
Печать
Anti-PRKRA
Кат. №: AV40475-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-PRKRA
Main image
Кат. №: AV40475-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-PRKRA
Кат. №: AV40475-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ Protein kinase, interferon-inducible double stranded RNA-dependent activator/protein activator of the interferon-induced protein kinase (PRKRA, PACT) is a stress-modulated cellular activator of interferon (IFN)-induced double-stranded (ds) RNA-activated protein kinase (PKR) which is involved in antiviral defense in mammals. PACT and Mammalian Dicer interacts with double-stranded RNA-binding protein (TRBP) and associate with Dicer to stimulate cleavage of double-stranded RNA found in short hairpin and short interfering RNA (siRNA)._x000D_ Specificity_x000D_ Anti-PRKRA polyclonal antibody reacts with bovine, canine, human, mouse, and rat protein kinase, interferon-inducible double stranded RNA-dependent activators/protein activator of the interferon-induced protein kinases._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human PRKRA_x000D_ Application_x000D_ Anti-PRKRA polyclonal antibody is used to tag protein kinase, interferon-inducible double stranded RNA-dependent activator/protein activator of the interferon-induced protein kinase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of protein activator of the interferon-induced protein kinase (PACT) in stress response, antiviral activity and double-stranded RNA processing._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA)._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA
Related Categories
Alphabetical Index, Antibodies, Antibodies for Epigenetics and Nuclear Signaling, Antibodies to RNA Binding Proteins, PR-PR, Primary AntibodiesMore... conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ Protein kinase, interferon-inducible double stranded RNA-dependent activator/protein activator of the interferon-induced protein kinase (PRKRA, PACT) is a stress-modulated cellular activator of interferon (IFN)-induced double-stranded (ds) RNA-activated protein kinase (PKR) which is involved in antiviral defense in mammals. PACT and Mammalian Dicer interacts with double-stranded RNA-binding protein (TRBP) and associate with Dicer to stimulate cleavage of double-stranded RNA found in short hairpin and short interfering RNA (siRNA)._x000D_ Specificity_x000D_ Anti-PRKRA polyclonal antibody reacts with bovine, canine, human, mouse, and rat protein kinase, interferon-inducible double stranded RNA-dependent activators/protein activator of the interferon-induced protein kinases._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human PRKRA_x000D_ Application_x000D_ Anti-PRKRA polyclonal antibody is used to tag protein kinase, interferon-inducible double stranded RNA-dependent activator/protein activator of the interferon-induced protein kinase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of protein activator of the interferon-induced protein kinase (PACT) in stress response, antiviral activity and double-stranded RNA processing._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA)._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA
Related Categories
Alphabetical Index, Antibodies, Antibodies for Epigenetics and Nuclear Signaling, Antibodies to RNA Binding Proteins, PR-PR, Primary AntibodiesMore... conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.