Печать
Anti-PRMT5
Кат. №: AV40185
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-PRMT5
Кат. №: AV40185
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_
Immunogen_x000D_
Synthetic peptide directed towards the N terminal region of human PRMT5_x000D_
Physical form_x000D_
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_
Disclaimer_x000D_
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_
Biochem/physiol Actions_x000D_
PRMT5 methylates specific arginine residues in the small nuclear ribonucleoproteins Sm D1 and Sm D3 to monomethylarginine and to symmetrical dimethylarginines (sDMAs). It methylates SUPT5H. PRMT5 plays a role in the assembly of snRNP core particles and may play a role in cytokine-activated transduction pathways. It negatively regulates cyclin E1 promoter activity and cellular proliferation and May regulate the SUPT5H transcriptional elongation properties. It may be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. PRMT5 methylates histone H2A/H4 ′Arg-3′ during germ cell development and methylates histone H3 ′Arg-8′, which may repress transcription._x000D_
Sequence_x000D_
Synthetic peptide located within the following region: FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS
Related Categories
Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies for Epigenetics and Nuclear Signaling, Antibodies for Gene Regulation and Expression, Antibodies for Modifying Enzyme Arginine Methylation, Antibodies to Most Studied Epigenetic Genes, Antibodies to Transcription Regulators, PR-PR, Primary AntibodiesMore... conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
