Description; Immunogen; Synthetic peptide directed towards the N terminal region of human RABGGTA; Application; Anti-RABGGTA antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Rab geranylgeranyltransferase, alpha subunit (RABGGTA; PTAR3) an enzyme that attaches geranylgeranyl groups to Rab proteins. The activity of this enzyme is essential for hemostasis and platelet synthesis. Polymorphisms in RABGGTA gene have been observed in patients with Hermansky-Pudlak syndrome.; Sequence; Synthetic peptide located within the following region: ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL