Description_x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human RBX1_x000D_ Application_x000D_ Anti-RBX1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ RBX1 is a component of SCF E3 ubiquitin ligase and participates in tagging and degradation of various substrates in the cell to maintain homeostasis. It is crucial in meiotic maturation process of mouse oocytes. RBX1 is essential maintaining the integrity of genome and for development and viability in C. elegans._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: NQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH