Перейти к контенту
Main image
Печать
Anti-RCOR2
Кат. №: AV34671
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-RCOR2
Main image
Кат. №: AV34671
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-RCOR2
Кат. №: AV34671
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; RCOR2 is a part of the LSD1 complex and is known to modulate ESC properties. RCOR2 also substitutes for SOX2 during somatic cell reprogramming. Rabbit Anti-RCOR2 antibody recognizes canine, bovine, human, mouse, and rat RCOR2.; Immunogen; Synthetic peptide directed towards the N terminal region of human RCOR2; Application; Rabbit Anti-RCOR2 antibody is suitable for western blot applications at a concentration of 1 mg/mL.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; RCOR2 may act as a component of a corepressor complex that represses transcription.; Sequence; Synthetic peptide located within the following region: YYYSWKKTRSRTSVMDRQARRLGGRKDKEDSDELEEGRGGVSEGEPDPAD
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; General description; RCOR2 is a part of the LSD1 complex and is known to modulate ESC properties. RCOR2 also substitutes for SOX2 during somatic cell reprogramming. Rabbit Anti-RCOR2 antibody recognizes canine, bovine, human, mouse, and rat RCOR2.; Immunogen; Synthetic peptide directed towards the N terminal region of human RCOR2; Application; Rabbit Anti-RCOR2 antibody is suitable for western blot applications at a concentration of 1 mg/mL.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; RCOR2 may act as a component of a corepressor complex that represses transcription.; Sequence; Synthetic peptide located within the following region: YYYSWKKTRSRTSVMDRQARRLGGRKDKEDSDELEEGRGGVSEGEPDPAD
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.