Description; Immunogen; Synthetic peptide directed towards the N terminal region of human RIN3; Application; Rabbit Anti-RIN3 antibody is suitable for western blot applications at a concentration of 5 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; RIN3, biochemically characterized as the stimulator and stabilizer for GTP-Rab5, plays an important role in the transport pathway from plasma membrane to early endosomes.; Sequence; Synthetic peptide located within the following region: AGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEEKSILYLEGSAL