Description; General description; Receptor-interacting protein kinase 1 (RIPK1) is known to activate NF-κB signaling and is also known to modulate apoptosis and caspase-8 stimulation. Rabbit Anti-RIPK1 antibody associates with human, and bovine RIPK1.; Immunogen; Synthetic peptide directed towards the middle region of human RIPK1; Application; Rabbit Anti-RIPK1 antibody can be used for western blot (0.25μg/ml) applications.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Sequence; Synthetic peptide located within the following region: RRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQ