Description_x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human SAMSN1_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ SAMSN1 (SAM domain, SH3 domain, and nuclear localization signals 1), also known as HACS1/SLY2/NASH1, is a member of a family of three adapter proteins that are highly homologous and characterized by the presence of protein-protein interaction domains. The SAMSN1 gene localizes to the 21q11.2 region on human chromosome 21. The transcript of SAMSN1 has been found in acute myeloid leukemia, lymphoma, and multiple myeloma cell-lines._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: YVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGY