Перейти к контенту
Main image
Печать
Anti-SEPT4
Кат. №: AV02014
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-SEPT4
Main image
Кат. №: AV02014
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-SEPT4
Кат. №: AV02014
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; Sept4 is a part of the Lewy body complexes that supress α-synuclien toxicity. Furthermore, Sept4 has been implicated in Parkinson′s disease, stem cell death and tumor supression. Rabbit Anti-SEPT4 antibody binds to canine, and human Sept4.; Immunogen; Synthetic peptide directed towards the N terminal region of human SEPT4 (septin-4); Application; Rabbit Anti-SEPT4 antibody can be used for IHC (4-8μg/ml, using paraffin-embedded tissues) and western blot (0.5μg/ml) applications.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Sequence; Synthetic peptide located within the following region: RSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKFVKDFSGNASCHPPEA
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; General description; Sept4 is a part of the Lewy body complexes that supress α-synuclien toxicity. Furthermore, Sept4 has been implicated in Parkinson′s disease, stem cell death and tumor supression. Rabbit Anti-SEPT4 antibody binds to canine, and human Sept4.; Immunogen; Synthetic peptide directed towards the N terminal region of human SEPT4 (septin-4); Application; Rabbit Anti-SEPT4 antibody can be used for IHC (4-8μg/ml, using paraffin-embedded tissues) and western blot (0.5μg/ml) applications.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Sequence; Synthetic peptide located within the following region: RSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKFVKDFSGNASCHPPEA
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.