Description; General description; SerTAD1 (or SEI1, TRIP-Br1) is a SERTA domain-containing protein that is required for neuron death in models of trophic support deprivation, DNA damage and Alzheimer′s disease. SERTAD1 is also known to function as a transcriptional coactivator of SMAD1 during mouse cardiogenesis. Rabbit Anti-SerTAD1 recognizes human, mouse, rat, and bovine SERTAD1.; Immunogen; Synthetic peptide directed towards the N terminal region of human SERTAD1; Application; Rabbit Anti-SerTAD1 can be used for western blot applications at a concentration of 0.125 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; SERTA is a transcriptional regulator that interacts with the PHD-bromodomain of co-repressors of Kruppel-associated box (KRAB)-mediated repression, KRIP-1(TIF1beta) and TIF1alpha, as well as the co-activator/adaptor p300/CBP. It is a component of a multiprotein complex containing E2F-1 and DP-1.; Sequence; Synthetic peptide located within the following region: MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQAPPAVASSSLFDLSV