Перейти к контенту
Main image
Печать
Anti-SF4
Кат. №: AV40961
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-SF4
Main image
Кат. №: AV40961
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-SF4
Кат. №: AV40961
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; Splicing factor 4/SURP and G patch domain containing 1 (SF4, RBP, SUGP1) is closely related to SFRS14 (arginine/serine-rich splicing factor 4) which is a potential normalization protein for gene expression studies in HCV-induced hepatocellular carcinoma (HCC).; Specificity; Anti-SF4 polyclonal antibody reacts with canine, bovine, zebrafish, human, mouse, and rat splicing factor 4/SURP and G patch domain containing 1 proteins.; Immunogen; Synthetic peptide directed towards the N terminal region of human SF4; Application; Anti-SF4 polyclonal antibody is used to tag splicing factor 4/SURP and G patch domain containing 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of splicing factor 4/SURP and G patch domain containing 1 in spliceosome formation and function.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; SF4 is a member of the SURP family of splicing factors.SF4 is a member of the SURP family of splicing factors.[supplied by OMIM].; Sequence; Synthetic peptide located within the following region: MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKM
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; General description; Splicing factor 4/SURP and G patch domain containing 1 (SF4, RBP, SUGP1) is closely related to SFRS14 (arginine/serine-rich splicing factor 4) which is a potential normalization protein for gene expression studies in HCV-induced hepatocellular carcinoma (HCC).; Specificity; Anti-SF4 polyclonal antibody reacts with canine, bovine, zebrafish, human, mouse, and rat splicing factor 4/SURP and G patch domain containing 1 proteins.; Immunogen; Synthetic peptide directed towards the N terminal region of human SF4; Application; Anti-SF4 polyclonal antibody is used to tag splicing factor 4/SURP and G patch domain containing 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of splicing factor 4/SURP and G patch domain containing 1 in spliceosome formation and function.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; SF4 is a member of the SURP family of splicing factors.SF4 is a member of the SURP family of splicing factors.[supplied by OMIM].; Sequence; Synthetic peptide located within the following region: MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKM
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.