Description_x000D_ General description_x000D_ Sideroflexin 4 (SFXN4) is a mitochondrial protein, localized in inner mitochondrial membrane. SFXN4 gene is located on human chromosome 10q26.11._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the C terminal region of human SFXN4_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter. Sideroflexin 4 (SFXN4) mutations are known to causemitochondriopathy and macrocytic anemia. SFXN4 is required for maintaining mitochondrial respiratory homeostasis and erythropoiesis. SFXN4 is upregulated in ovarian cancer patients._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV