Description_x000D_ General description_x000D_ This gene encodes a protein with an important role in the apoptotic (programmed cell death) pathway induced by the CD27 antigen, a member of the tumor necrosis factor receptor (TFNR) superfamily. The CD27 antigen cytoplasmic tail binds to the N-terminus of this protein. Two alternatively spliced transcript variants encoding distinct proteins have been described. (provided by RefSeq)_x000D_ Immunogen_x000D_ SIVA (NP_006418, 1 a.a. ~ 175 a.a) full-length human protein._x000D_ Sequence_x000D_ MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4