Description_x000D_ General description_x000D_ Solute carrier family 30, member 1 (SLC30A1, ZNT1, ZRC1) is a zinc transporter involved in regulating zinc and other divalent cation flux. SLC30A1/ ZNT1 is frequently coexpressed with L-type voltage-dependent calcium channel (LTCC), a major route for zinc influx. SLC30A1/ ZNT1 is believed to regulate cellular ion (calcium, cadmium, zinc) homeostasis, at least in part, by modulating/inhibiting L-type calcium channels._x000D_ Specificity_x000D_ Anti-SLC30A1 polyclonal antibody reacts with human, canine, and pig solute carrier family 30, member 1/ZNT1 proteins._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human SLC30A1_x000D_ Application_x000D_ Anti-SLC30A1 polyclonal antibody is used to tag solute carrier family 30, member 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 30, member 1 in divalent cation (Zn2+, Cd2+, Ca2+) homeostasis, especially in conjunction with L-type voltage-dependent calcium channels._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ SLC30A1 may be involved in zinc transport out of the cell._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLY