Перейти к контенту
Main image
Печать
Anti-SLC38A1
Кат. №: AV43810
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-SLC38A1
Main image
Кат. №: AV43810
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-SLC38A1
Кат. №: AV43810
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ Solute carrier family 38, member 1/sodium-coupled neutral amino acid transporter 1 (SLC38A1, ATA1, NAT2, SAT1, SNAT1), which is expressed during embryogenesis, is a sodium-dependent transporter of neutral zwitterionic amino acids, such a glutamine. SLC38A1/SAT1 is believed to be involved in translocation of glutamine into GABAergic neurons to facilitate inhibitory neurotransmitter generation._x000D_ Specificity_x000D_ Anti-SLC38A1 (AB1) polyclonal antibody reacts with canine and human solute carrier family 38, member 1 proteins._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human SLC38A1_x000D_ Application_x000D_ Anti-SLC38A1 (AB1) polyclonal antibody is used to tag solute carrier family 38, member 1/sodium-coupled neutral amino acid transporter for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 38, member 1 in transport of important neutral zwitterionic amino acids, such a glutamine, during embryogenesis and in neural function._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, SLC3-SLZ conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ Solute carrier family 38, member 1/sodium-coupled neutral amino acid transporter 1 (SLC38A1, ATA1, NAT2, SAT1, SNAT1), which is expressed during embryogenesis, is a sodium-dependent transporter of neutral zwitterionic amino acids, such a glutamine. SLC38A1/SAT1 is believed to be involved in translocation of glutamine into GABAergic neurons to facilitate inhibitory neurotransmitter generation._x000D_ Specificity_x000D_ Anti-SLC38A1 (AB1) polyclonal antibody reacts with canine and human solute carrier family 38, member 1 proteins._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human SLC38A1_x000D_ Application_x000D_ Anti-SLC38A1 (AB1) polyclonal antibody is used to tag solute carrier family 38, member 1/sodium-coupled neutral amino acid transporter for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 38, member 1 in transport of important neutral zwitterionic amino acids, such a glutamine, during embryogenesis and in neural function._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, SLC3-SLZ conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.