Перейти к контенту
Main image
Печать
Anti-SREBF1
Кат. №: AV37145-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-SREBF1
Main image
Кат. №: AV37145-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-SREBF1
Кат. №: AV37145-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; Sterol regulatory element-binding transcription factor 1 (SREBF1) also known as SREBP-1 binds to a sequence in the promoter of different genes, called sterol regulatory element-1 (SRE1). Upon cleavage of the precursor form of the protein, SREBF1 gets translated into the nucleus where it induces transcription of genes involved in glucose metabolism and fatty acid and lipid production. Sterols block cleavage of the precursor protein inhibiting transcription.; Immunogen; Synthetic peptide directed towards the N terminal region of mouse SREBF1; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Srebf1 is transcriptional activator that binds to the sterol regulatory element 1 (SRE-1) (5′-ATCACCCCAC-3′). Srebf1 also binds to an E-box motif (5′-ATCACGTGA-3′). Srebf1 regulates the transcription of genes for sterol biosynthesis and the LDL receptor gene.; Sequence; Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; General description; Sterol regulatory element-binding transcription factor 1 (SREBF1) also known as SREBP-1 binds to a sequence in the promoter of different genes, called sterol regulatory element-1 (SRE1). Upon cleavage of the precursor form of the protein, SREBF1 gets translated into the nucleus where it induces transcription of genes involved in glucose metabolism and fatty acid and lipid production. Sterols block cleavage of the precursor protein inhibiting transcription.; Immunogen; Synthetic peptide directed towards the N terminal region of mouse SREBF1; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Srebf1 is transcriptional activator that binds to the sterol regulatory element 1 (SRE-1) (5′-ATCACCCCAC-3′). Srebf1 also binds to an E-box motif (5′-ATCACGTGA-3′). Srebf1 regulates the transcription of genes for sterol biosynthesis and the LDL receptor gene.; Sequence; Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.