Печать
Anti-ST6GALNAC5
Кат. №: AV49986
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-ST6GALNAC5
Кат. №: AV49986
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; Immunogen; Synthetic peptide directed towards the middle region of human ST6GALNAC5; Application; Anti-ST6GALNAC5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; ST6GALNAC5 is a sialtransferase expressed in forebrain and cerebellum and involved in the modification of proteins and ceramides present on the cell surface. It may regulate cell-cell or cell-extracellular matrix interactions. Mutations in ST6GALNAC5 gene might cause coronary artery disease.; Sequence; Synthetic peptide located within the following region: AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
