Description_x000D_ General description_x000D_ Mitochondrial transcription factor A (TFAM) belongs to the high mobility group proteins and is required for mitochondrial DNA (mtDNA) maintenance. Studies have reported that human mtDNA is packed with TFAM._x000D_ Rabbit Anti-TFAM (AB1) antibody recognizes bovine, canine, human, mouse, and pig TFAM._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human TFAM_x000D_ Application_x000D_ Rabbit Anti-TFAM (AB1) antibody can be used for western blotting applications at 0.25μg/ml._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS