Description; General description; Tfcp2l1 is a transcription factor that belongs to the CP2 family of proteins. This transcription factor has been implicated in the self-renewal pathways of embryonic stem (ES) cells. TFCP2L1 may also be involved in the differentiation of epithelial cells. Rabbit Anti-TFCP2L1 recognizes bovine, chicken, human, mouse, and rat TFCP2L1.; Immunogen; Synthetic peptide directed towards the N terminal region of human TFCP2L1; Application; Rabbit Anti-TFCP2L1 can be used for western blot (2μg/ml) and IHC (4-8μg/ml, using paraffin embedded tissues) applications.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; TFCP2L1 is a candidate CP2 family member. It is expressed in a developmentally regulated fashion in vivo and acts as a direct repressor of transcription. CP2-related proteins comprise a family of DNA-binding transcription factors that are generally activators of transcription and expressed ubiquitously.; Sequence; Synthetic peptide located within the following region: LRDVLALPIFKQEEPQLSPENEARLPPLQYVLCAATSPAVKLHEETLTYL