Description; General description; TFEC is a basic helix-loop-helix protein that forms heterodimers with TFE3 and subsequently blocks transcriptional stimulation. TFEC may be involved in the regulation of macrophage-specific genes. Rabbit Anti-TFEC antibody recognizes mouse, canine, bovine, rat, and human TFEC.; Immunogen; Synthetic peptide directed towards the N terminal region of human TFEC; Application; Rabbit Anti-TFEC antibody can be used for western blot applications at a concentration of 0.25μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; TFEC is an activator of transcription with two separate activation domains.; Sequence; Synthetic peptide located within the following region: MESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSL