Description_x000D_ General description_x000D_ THAP domain containing 1 (THAP1) is a transcription factor encoded by the gene mapped to human chromosome 18p11.21. The encoded protein contains an N-terminal conserved DNA-binding domain, designated THAP domain with a zinc-finger structure._x000D_ The protein encoded by this gene contains a THAP domain, a conserved DNA-binding domain. This protein colocalizes with the apoptosis response protein PAWR/PAR-4 in promyelocytic leukemia (PML) nuclear bodies, and functions as a proapoptotic factor that links PAWR to PML nuclear bodies. Alternatively spliced transcript variants encoding distinct isoforms have been observed. (provided by RefSeq)_x000D_ Immunogen_x000D_ THAP1 (NP_060575.1, 1 a.a. ~ 213 a.a) full-length human protein._x000D_ Sequence_x000D_ MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Biochem/physiol Actions_x000D_ THAP domain containing 1 (THAP1) plays a key role in endothelial cell proliferation and pro-apoptotic processes. Mutation in the gene is associated with primary dystonia type 6 (DYT6). The encoded protein links prostate-apoptosis-response-4 (Par-4) to promyelocytic leukemia (PML) nuclear bodies, which facilitates both serum withdrawal and tumor necrosis factor-α (TNFα)-induced apoptosis.