Перейти к контенту
Main image
Печать
Anti-TRIM32
Кат. №: AV38966-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-TRIM32
Main image
Кат. №: AV38966-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-TRIM32
Кат. №: AV38966-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; Tripartite motif-containing 32 (TRIM32, BBS11, HT2A, LGMD2H, TATIP) is an E3 ubiquitin ligase that ubiquitinates proteins such as c-Myc, dysbindin, actin, paisy, and abl-interactor 2 (ABI2). TRIM32 is involved in the regulation of miRNA activation and the induction of neuronal differentiation in brain regions such as the neocortex. TRIM32 regulates skeletal muscle stem cell differentiation; Specificity; Anti-TRIM32 (AB2) polyclonal reacts with bovine, human, mouse, rat, zebrafish, and canine tripartite motif-containing 32 proteins.; Immunogen; Synthetic peptide directed towards the C terminal region of human TRIM32; Application; Anti-TRIM32 (AB2) polyclonal antibody is used to tag tripartite motif-containing 32 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of tripartite motif-containing 32 in cell differentiation via miRNA regulation and ubiquitination of key regulatory proteins.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.; Sequence; Synthetic peptide located within the following region: GQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGY
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; General description; Tripartite motif-containing 32 (TRIM32, BBS11, HT2A, LGMD2H, TATIP) is an E3 ubiquitin ligase that ubiquitinates proteins such as c-Myc, dysbindin, actin, paisy, and abl-interactor 2 (ABI2). TRIM32 is involved in the regulation of miRNA activation and the induction of neuronal differentiation in brain regions such as the neocortex. TRIM32 regulates skeletal muscle stem cell differentiation; Specificity; Anti-TRIM32 (AB2) polyclonal reacts with bovine, human, mouse, rat, zebrafish, and canine tripartite motif-containing 32 proteins.; Immunogen; Synthetic peptide directed towards the C terminal region of human TRIM32; Application; Anti-TRIM32 (AB2) polyclonal antibody is used to tag tripartite motif-containing 32 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of tripartite motif-containing 32 in cell differentiation via miRNA regulation and ubiquitination of key regulatory proteins.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.; Sequence; Synthetic peptide located within the following region: GQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGY
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.