Перейти к контенту
Main image
Печать
Anti-YWHAZ
Кат. №: AV48046
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-YWHAZ
Main image
Кат. №: AV48046
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-YWHAZ
Кат. №: AV48046
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta (YWHAZ) is a member of the 14-3-3 family that regulates signal transduction. Increased expression of YWHAZ has been linked to the growth and metastasis of gastric carcinoma. YWHAZ amplification is associated with breast cancer recurrence and chemotherapy resistance._x000D_ Rabbit Anti-YWHAZ antibody recognizes chicken, bovine, pig, human, mouse, rat, and canine YWHAZ._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the C terminal region of human YWHAZ_x000D_ Application_x000D_ Rabbit Anti-YWHAZ antibody is suitable for western blot applications at a concentration of 5μg/ml._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity.This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Two transcript variants differing in the 5′ UTR, but encoding the same protein, have been identified for this gene._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, Y conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta (YWHAZ) is a member of the 14-3-3 family that regulates signal transduction. Increased expression of YWHAZ has been linked to the growth and metastasis of gastric carcinoma. YWHAZ amplification is associated with breast cancer recurrence and chemotherapy resistance._x000D_ Rabbit Anti-YWHAZ antibody recognizes chicken, bovine, pig, human, mouse, rat, and canine YWHAZ._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the C terminal region of human YWHAZ_x000D_ Application_x000D_ Rabbit Anti-YWHAZ antibody is suitable for western blot applications at a concentration of 5μg/ml._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity.This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Two transcript variants differing in the 5′ UTR, but encoding the same protein, have been identified for this gene._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, Y conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.