Перейти к контенту
Main image
Печать
Anti-ZDHHC16
Кат. №: AV50062
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-ZDHHC16
Main image
Кат. №: AV50062
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-ZDHHC16
Кат. №: AV50062
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human ZDHHC16_x000D_ Application_x000D_ Anti-ZDHHC16 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Zinc finger, DHHC-type containing 16 (ZDHHC16; APH2; DHHC-16) is c-Abl interacting protein that is localized to endoplasmic reticulum. It may be involved in ER stress-induced apoptosis and exhibit pro-apoptotic activity. It may also interact with JAB1 protein and negatively regulate the activation of AP-1._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: SVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKC
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, ZA-ZM conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human ZDHHC16_x000D_ Application_x000D_ Anti-ZDHHC16 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Zinc finger, DHHC-type containing 16 (ZDHHC16; APH2; DHHC-16) is c-Abl interacting protein that is localized to endoplasmic reticulum. It may be involved in ER stress-induced apoptosis and exhibit pro-apoptotic activity. It may also interact with JAB1 protein and negatively regulate the activation of AP-1._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: SVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKC
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, ZA-ZM conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.