Печать
ANTI-ZEB2
Кат. №: SAB2108744-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
ANTI-ZEB2
Кат. №: SAB2108744-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_
Immunogen_x000D_
Synthetic peptide directed towards the middle region of human ZEB2_x000D_
Physical form_x000D_
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_
Disclaimer_x000D_
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_
Biochem/physiol Actions_x000D_
The ZFHX1B gene is a member of the delta-EF1/Zfh1 family of 2-handed zinc finger/homeodomain proteins. ZFHX1B is strongly transcribed at an early stage in the developing peripheral and central nervous systems of both mice and humans, in all neuronal regions of the brains of 25-week human fetuses and adult mice, and in numerous nonneural tissues. The SMADIP1 gene (also known as SIP1) is a member of the delta-EF1 (ZEB1; MIM 189909)/Zfh1 family of 2-handed zinc finger/homeodomain proteins. SMADIP1 interacts with receptor-mediated, activated full-length SMADs (see MIM 605568) (Verschueren et al., 1999 [PubMed 10400677]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-58 AB056507.1 1-58 59-553 AL118674.1 57-551 554-5558 AB056507.1 553-5557 5559-5583 AI858477.1 1-25 c_x000D_
Sequence_x000D_
Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, ZA-ZM conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
