Description_x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human ZFP57_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ ZFP57 is a protein similar to zinc finger protein 57. It is derived from an annotated genomic sequence (NT_007592) using gene prediction method._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: MFEQLKPIEPRDCWREARVKKKPVTFEDVAVNFTQEEWDCLDASQRVLYQ