Перейти к контенту
Main image
Печать
Anti-ZHX2
Кат. №: AV37629-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-ZHX2
Main image
Кат. №: AV37629-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-ZHX2
Кат. №: AV37629-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; Immunogen; Synthetic peptide directed towards the C terminal region of mouse ZHX2; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; ZHX2 a zinc fingers and homeoboxes (ZHX) protein that is directly involved in the regulation of AFP synthesis. It also controls AFP levels only indirectly, e.g., by regulating the synthesis of a hormone that controls AFP synthesis.; Sequence; Synthetic peptide located within the following region: SGIVDFVEVTVGEEDAISEKWGSWSRRVAEGTVERADSDSDSTPAEAGQA
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; Immunogen; Synthetic peptide directed towards the C terminal region of mouse ZHX2; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; ZHX2 a zinc fingers and homeoboxes (ZHX) protein that is directly involved in the regulation of AFP synthesis. It also controls AFP levels only indirectly, e.g., by regulating the synthesis of a hormone that controls AFP synthesis.; Sequence; Synthetic peptide located within the following region: SGIVDFVEVTVGEEDAISEKWGSWSRRVAEGTVERADSDSDSTPAEAGQA
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.