Description_x000D_ General description_x000D_ ZMyND11 is a zinc-finger protein that links H3, 3K36me3 to tumor suppression and transcriptional elongation. ZMyND11 has also been implicated in poorly differentiated myeloid leukemia._x000D_ Rabbit Anti-ZMyND11 antibody recognizes bovine, chicken, human, mouse, rat, and canine ZMyND11._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human ZMYND11_x000D_ Application_x000D_ Rabbit Anti-ZMyND11 (AB1) antibody is suitable for western blot (2.5 μg/ml) and IHC (4-8 μg/ml) assays._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ ZMYND11 was first identified by its ability to bind the adenovirus E1A protein. The protein localizes to the nucleus. It functions as a transcriptional repressor, and expression of E1A inhibits this repression._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: SMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKV