Description; General description; ZNF394 is a zinc finger protein that can inhibit the transcriptional functions of c-JUN and AP-1. Hence, ZNF394 is known to function as a negative regulator of mitogen-activated protein kinase signaling. ZNF394 may also modulate heart functions. Rabbit Anti-ZNF394 (AB1) antibody binds to human ZNF394 (AB1).; Immunogen; Synthetic peptide directed towards the N terminal region of human ZNF394; Application; Rabbit Anti-ZNF394 (AB1) antibody can be used for immunohistochemistry (4-8μg/ml, using paraffin-embedded tissues) and western blot (0.25μg/ml) assays.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; ZNF394 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.; Sequence; Synthetic peptide located within the following region: GPWVMAARSKDAAPSQRDGLLPVKVEEDSPGSWEPNYPAASPDPETSRLH