Description; Immunogen; Synthetic peptide directed towards the C terminal region of human ZNF555; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; ZNF555 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 15 C2H2-type zinc fingers and 1 KRAB domain. ZNF555 may be involved in transcriptional regulation.; Sequence; Synthetic peptide located within the following region: LRRHVRIHTTEKQYKCNVGHPPANEFMCSASEKSHQERDLIKVVNMVLPL