Description; Immunogen; Synthetic peptide directed towards the C terminal region of human ZP3; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; ZP3 protein is a structural component of zona pellucida, an extracellular matrix that surrounds the oocyte and the early embryo. ZP3 mediates the binding and induction of the sperm acrosome reaction.; Sequence; Synthetic peptide located within the following region: NKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVGATDLPGQEW