Перейти к контенту
Main image
Печать
Anti-ZSCAN21
Кат. №: AV39869-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-ZSCAN21
Main image
Кат. №: AV39869-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-ZSCAN21
Кат. №: AV39869-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ The gene ZSCAN21 (zinc finger and SCAN domain containing 21), also referred to as NY-REN-21, encodes a C2H2 type multi-finger protein that contains an N-terminal SCAN (SRE-ZBP, CTfin51, AW-1 (ZNF174), and Number 18 cDNA or ZnF20) domain and a predicted coil at the central region. The SCAN domain has the ability to form homodimers._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the C terminal region of human ZSCAN21_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ The gene ZSCAN21 (zinc finger and SCAN domain containing 21) encodes a transcription factor that transcriptionally regulates the gene SNCA that encodes α-synuclein in primary neuronal cultures. α-Synuclein is a presynaptic neuronal protein that is associated with Parkinson disease (PD). Therefore, the ZSCAN21 gene may serve as a potential target in the treatment of PD._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: AFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTGEGEAP
Related Categories
Alphabetical Index, Antibodies, Antibodies for Epigenetics and Nuclear Signaling, Antibodies to Transcription Factors, Primary Antibodies, ZN - ZZ, ZP-ZZMore... conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ The gene ZSCAN21 (zinc finger and SCAN domain containing 21), also referred to as NY-REN-21, encodes a C2H2 type multi-finger protein that contains an N-terminal SCAN (SRE-ZBP, CTfin51, AW-1 (ZNF174), and Number 18 cDNA or ZnF20) domain and a predicted coil at the central region. The SCAN domain has the ability to form homodimers._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the C terminal region of human ZSCAN21_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ The gene ZSCAN21 (zinc finger and SCAN domain containing 21) encodes a transcription factor that transcriptionally regulates the gene SNCA that encodes α-synuclein in primary neuronal cultures. α-Synuclein is a presynaptic neuronal protein that is associated with Parkinson disease (PD). Therefore, the ZSCAN21 gene may serve as a potential target in the treatment of PD._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: AFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTGEGEAP
Related Categories
Alphabetical Index, Antibodies, Antibodies for Epigenetics and Nuclear Signaling, Antibodies to Transcription Factors, Primary Antibodies, ZN - ZZ, ZP-ZZMore... conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.