Description_x000D_ General description_x000D_ ANAPC11 (Anaphase promoting complex subunit 11) is a E3 ubiquitin ligase consisting of a RING-H2-finger domain with one histidine and seven cysteine residues that coordinate two Zn(2+) ions. It is mapped on the human chromosome 17q25 and is expressed in the cytoplasm and nucleus with discrete accumulation in granular structures in all the cell lines (AML 12, HepG2, and C2C12) transfected._x000D_ Immunogen_x000D_ ANAPC11 (AAH00607, 1 a.a. ~ 54 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ ANAPC11 (Anaphase promoting complex subunit 11) plays a key role in cell division by accelerating ubiquitination of cell-cycle regulators such as cyclin B and securin. It acts as the catalytic subunit of anaphase-promoting complex (APC) and helps to translocate ubiquitin from a ubiquitin-conjugating enzyme (E2) to the substrate. It controls the cell cycle progression through G1 phase of the cell cycle during protein modification.