Description_x000D_ General description_x000D_ Ankyrin repeat domain 37 (ANKRD37) is a protein containing ankyrin repeats (ARs) and a nuclear localization signal (NLS). The protein is expressed in human testis, small intestine, colon, blood leukocytes and human pancreatic adenocarcinoma cells. The gene is located on human chromosome 4q35.1._x000D_ Immunogen_x000D_ ANKRD37 (NP_859077.1, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Biochem/physiol Actions_x000D_ Ankyrin repeat domain 37 (ANKRD37) is important in protein-protein interactions and signalling pathways. It acts as a target gene for hypoxia-inducible factor 1 (HIF-1).