Description_x000D_ General description_x000D_ Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. (provided by RefSeq)_x000D_ Immunogen_x000D_ ARHGEF10 (NP_055444, 792 a.a. ~ 890 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ GKQDKSGRPTFFTAVFNTFTPAIKESWVNSLQMAKLALEEENHMGWFCVEDDGNHIKKEKHPLLVGHMPVMVAKQQEFKIECAAYNPEPYLNNESQPDS_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Biochem/physiol Actions_x000D_ ARHGEF10 (Rho guanine nucleotide exchange factor 10) works as a guanine nucleotide exchange factor for RhoA, RhoB and RhoC. It is involved in atherosclerotic cerebral infarction and mutation in ARHGEF10 is associated with increased risk of atherothrombotic stroke. Mutation in ARFGEF10 is also linked with slowed nerve conduction velocities and thin myelination of peripheral nerves.