Description_x000D_ General description_x000D_ Glycoprotein-N- acetylgalactosamine 3-β- galactosyltransferase 1 (C1GALT1) is localized in the Golgi apparatus. The gene encoding it contains three exons spanning 10 kb. It is located on chromosome 7p14-p13._x000D_ Immunogen_x000D_ C1GALT1 (NP_064541, 264 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ ETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ Glycoprotein-N- acetylgalactosamine 3-β- galactosyltransferase 1 (C1GALT1) functions in the addition of galactose onto GalNAc residues of IgA1. Thus, it generates the core 1 O-glycan Galβ1-3GalNAα1-SerThr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. A deficiency of C1GALT1 results in IgA nephropathy, Tn syndrome and also Henoch-Schönlein purpura. It increases the proliferation of hepatocellular carcinoma cells by regulating MET glycosylation and dimerization. C1GALT1 also regulates angiogenesis, kidney development and thrombopoiesis.