Description_x000D_ General description_x000D_ C-C motif chemokine ligand 19 (CCL19) is a homeostatic chemokine expressed in secondary lymphoid tissue. The gene encoding it is localized on human chromosome 9p13._x000D_ Immunogen_x000D_ CCL19 (AAH27968, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS_x000D_ Physical form_x000D_ Clear solution_x000D_ Biochem/physiol Actions_x000D_ C-C motif chemokine ligand 19 (CCL19) is involved in adaptive immune system. It recruits monocytes, macrophages, antigen presenting dendritic cells and naive T-cells to secondary lymphoid organs by activation of C-C motif chemokine receptor 7 (CCR7). The protein controls cell migration and angiogenesis in many types of diseases. CCL19 is upregulated in human atherosclerotic lesions. It is also involved in the development of various inflammatory disorders such as asthma, atherosclerosis and rheumatoid arthritis, and might be associated with the pathogenesis of rickettsiae infection.